Cat: PA1000-3469

Recombinant Human VPS26A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VPS26A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VPS26A;VPS26;Vacuolar Protein sorting-associated Protein 26A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75436

  • Expression Region

    1-327aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSFLGGFFGPICEIDIVLNDGETRKMA EMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIE LFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVR LRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIE FEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTET ETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLV LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VPS26A is a crucial component of the retromer complex, which plays a significant role in intracellular trafficking and the recycling of membrane proteins. Research has shown that VPS26A is involved in the transport of cargo from endosomes to the trans-Golgi network, influencing various cellular processes, including nutrient sensing, signaling pathways, and cellular responses to stress. Mutations or dysregulation of VPS26A have been implicated in numerous diseases, particularly neurodegenerative disorders, where impaired protein recycling contributes to toxic protein accumulation. Recent studies have focused on understanding the structural and functional properties of VPS26A, exploring its interactions with other retromer components and downstream effectors to elucidate its role in cargo recognition and trafficking. Additionally, the development of VPS26A as a potential therapeutic target is being investigated, aiming to restore normal trafficking mechanisms in pathological conditions. This protein's significance in maintaining cellular homeostasis underscores the need for comprehensive studies, paving the way for novel approaches in treating diseases associated with retromer dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US