Analytical Data
-
Gene name
PEX11G
- Application
-
Alternative Names
PEX11G; PEX11C; Peroxisomal membrane protein 11C; Peroxin-11C; Peroxisomal biogenesis factor 11C; Protein PEX11 homolog gamma; PEX11-gamma
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HA9
-
AA Sequence
MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP
-
Molecular Weight
26.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PEX11G is a member of the PEX11 family of proteins that are pivotal in the regulation of peroxisome biogenesis and division. Peroxisomes are essential organelles involved in various metabolic functions, including the oxidation of fatty acids and the detoxification of hydrogen peroxide. Their dysfunction is associated with several metabolic disorders, highlighting the importance of understanding the molecular mechanisms governing their dynamics. PEX11G, in particular, plays a significant role in the proliferation of peroxisomes in response to metabolic needs. Research on PEX11G has progressed to explore its structure-function relationships, protein interactions, and regulatory pathways. Studies indicate that PEX11G modulates peroxisome size and number by influencing the recruitment of additional proteins essential for organelle fission and biogenesis. Moreover, recent investigations have suggested that PEX11G operates through a coordinated mechanism involving various signaling pathways that respond to cellular metabolic states, thereby linking peroxisome dynamics with overall cellular homeostasis. This makes PEX11G a compelling target for further studies aimed at elucidating the intricacies of peroxisome biology and its implications in human health and disease. Understanding PEX11G and its functional dynamics could provide potential therapeutic avenues for treating peroxisome-related disorders. Ultimately, a deeper comprehension of how PEX11G and its homologs regulate peroxisome biology will enhance our knowledge of cell metabolism and its disorders.
