Cat: PA2000-1604

Recombinant Human OSTb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OSTb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OSTb;OSTB;Organic solute transporter subunit beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86UW2

  • Expression Region

    1-128aa

  • AA Sequence

    MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES

  • Molecular Weight

    14.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OSTb (Oligosaccharyltransferase beta) is a crucial enzyme involved in the process of N-glycosylation, a post-translational modification essential for the proper folding, stability, and function of glycoproteins. In recent years, the study of OSTb has gained significant attention due to its role in various biological processes and its implications in diseases such as cancer and congenital disorders. The enzymatic activity of OSTb is pivotal in transferring oligosaccharides to nascent polypeptides as they emerge from the ribosome, ensuring that glycoproteins acquire their necessary glycans. These modifications are critical for cell-cell communication, immune response, and protein stability. As a result, understanding the structural and functional properties of OSTb can provide insights into its mechanisms of action, as well as its potential as a therapeutic target. The recombinant production of OSTb has facilitated detailed studies on its enzymatic activity, substrate specificity, and interaction with other cellular components. Recent advances in biotechnology have enabled the generation of high-yield OSTb protein, allowing for in-depth investigations into its biological functions and its role in various cellular pathways. Such research not only enhances our fundamental understanding of glycosylation but also opens avenues for the development of novel therapeutic strategies aimed at manipulating glycosylation pathways in diseases where OSTb activity is altered. Overall, OSTb and its associated research represent a promising frontier in both basic and applied biological sciences, highlighting the complexity of glycoprotein synthesis and its far-reaching implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US