Analytical Data
-
Gene name
OXM
- Application
-
Alternative Names
OXM；Olfactory receptor 51M1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01275
-
Expression Region
53-89aa
-
AA Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
-
Molecular Weight
6.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OXM (Oxyntomodulin) is a peptide hormone produced in the intestines, primarily known for its role in regulating appetite and glucose metabolism. It is derived from proglucagon, alongside other important peptides like glucagon and GLP-1. The interest in OXM has surged due to its dual action in promoting satiety while simultaneously enhancing insulin sensitivity, making it a potential therapeutic target for obesity and type 2 diabetes. Research into OXM recombinant proteins aims to explore their physiological effects, molecular mechanisms, and potential applications in metabolic disorders. Studies have indicated that OXM can impact energy expenditure and body weight regulation, highlighting its relevance in the context of obesity management. Furthermore, the exploration of OXM as an avenue for drug development has led to advancements in understanding its receptor interactions and signaling pathways. These insights are crucial for developing OXM-based therapies with improved efficacy and reduced side effects. Overall, the OXM recombinant protein research holds promise for providing new strategies in the treatment of metabolic diseases, as well as enhancing our understanding of hormonal regulation of energy balance.
