Analytical Data
-
Gene name
VAMP5
- Application
-
Alternative Names
VAMP5；Vesicle-associated membrane Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95183
-
Expression Region
1-116aa
-
AA Sequence
MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VAMP5, or Vesicle-Associated Membrane Protein 5, is a member of the SNARE (Soluble N-ethylmaleimide-sensitive factor attachment protein receptor) family, which plays a crucial role in membrane trafficking and fusion processes within cells. As a key component in the transport of vesicles, VAMP5 is primarily involved in exocytosis and endocytosis, facilitating the movement of proteins and lipids between cellular compartments. Its importance is highlighted in various physiological processes, including neurotransmitter release, hormone secretion, and synaptic plasticity. Research on VAMP5 has grown due to its potential implications in understanding various diseases, such as diabetes, neurodegenerative disorders, and cancer, where membrane trafficking is often disrupted. Recombinant VAMP5 protein studies provide insights into its structural and functional properties, aiding in the elucidation of its role in membrane dynamics. By investigating VAMP5 interactions with other SNARE proteins and their regulatory mechanisms, researchers aim to uncover new therapeutic targets and strategies for diseases linked to vesicle transport dysfunction. Additionally, the development of VAMP5-based assays and models could enhance our understanding of cellular communication and the precise molecular machinery involved in synaptic transmission.
