Cat: PA2000-1597

Recombinant mouse CKAP4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CKAP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CKAP4;Cytoskeleton-associated Protein 4

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8BMK4

  • Expression Region

    109-575aa

  • AA Sequence

    VLEEVQQVRRGHQDFSRQRDELGQGLQGVEQKVQSLQATFGTFESLLRNS QHKQDLTEKAVKEGESELNRISEVLQKLQNEILKDLSDGIHVVKDARERD FTSLENTVEERLTELTKSINDNIAIFTDVQKRSQKEINEVKMKVASLEES KGDRSQDVKTLKDAVKEVQASMMSRERDIEALKSSLQTMESDVYTEVREL VSLKQEQQAFKQAADSERLALQALTEKLLRSEESSSRLPEDIRRLEEELQ QLKVGAHGSEEGAVFKDSKALEELQRQIEGLGARLQYVEDGVYSMQVASA RHTESLESLLSKSQEYEQRLAMLQEHVGNLGSSSDLASTVRSLGETQLAL SSDLKELKQSLGELPGTVESLQEQVLSLLSQDQAQAEGLPPQDFLDRLSS LDNLKSSVSQVESDLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLR NDLDRLFLKVEKIHEKI

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CKAP4, also known as Cytoskeleton-Associated Protein 4, is a membrane-associated protein primarily expressed in the cytoskeleton and has been implicated in various cellular processes, including cell adhesion, migration, and signal transduction. Recent studies have highlighted its role in cancer biology, particularly in the metastasis of tumor cells, suggesting that CKAP4 might function as a potential biomarker for aggressive cancers or as a target for therapeutic interventions. The understanding of CKAP4's structure and function at the molecular level is critical for elucidating its biological roles and potential clinical applications. Research on CKAP4 recombinant proteins is essential for characterizing its interactions with other cellular components, assessing its expression patterns in different cellular contexts, and evaluating its functionality in vitro and in vivo. Additionally, generating CKAP4 recombinant proteins can facilitate the development of assays to screen for small molecules that modulate its activity, paving the way for novel cancer therapies. Overall, the investigation of CKAP4 recombinant proteins is a promising area of study that could provide insights into cell biology and contribute to the advancement of cancer treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US