Cat: PA1000-3430

Recombinant Human USF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    USF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    USF1;BHLHB11;Upstream stimulatory factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22415

  • Expression Region

    1-310aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSH MGSMKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNV KYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQG AFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEA LLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRD EKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKA CDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLR HHGLEVVIKNDSN

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

USF1, or Upstream Stimulatory Factor 1, is a key transcription factor involved in the regulation of genes associated with lipid metabolism, glucose homeostasis, and insulin signaling. Its role in these metabolic pathways has drawn significant attention, particularly in the context of obesity and type 2 diabetes, conditions that are becoming increasingly prevalent worldwide. Research has shown that polymorphisms in the USF1 gene are linked to metabolic syndrome, indicating its importance in the predisposition to metabolic disorders. Additionally, USF1 interacts with several key metabolic pathways, including those associated with the peroxisome proliferator-activated receptors (PPARs), thereby influencing cellular responses to dietary fat and glucose levels. The study of USF1 and its downstream effects offers valuable insights into the molecular mechanisms underlying metabolic regulation, highlighting its potential as a therapeutic target for metabolic diseases. Overall, understanding the structural and functional properties of USF1, including its protein-protein interactions and effects on gene expression, may contribute to the development of novel strategies for combating metabolic disorders and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US