Cat: PA1000-3431

Recombinant Human USP14 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    USP14

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    USP14;TGT;Ubiquitin carboxyl-terminal hydrolase 14

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P54578

  • Expression Region

    2-494aa

  • AA Sequence

    PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGG TLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAM ELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQY ITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDAN ECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEF ETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPL MLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKY EPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFD DDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

USP14 (Ubiquitin-specific protease 14) is a deubiquitinating enzyme that plays a critical role in the regulation of protein turnover and cellular homeostasis by removing ubiquitin moieties from proteasomal substrates. Its involvement in various cellular processes, including protein quality control, signal transduction, and stress responses, highlights its significance in maintaining cellular functions. Research has shown that dysregulation of USP14 is associated with several neurodegenerative diseases, such as Alzheimer's disease and Parkinson's disease, where the accumulation of misfolded or damaged proteins occurs. Understanding the functional mechanisms of USP14 may provide insights into therapeutic strategies for these conditions. The study of recombinant USP14 protein has garnered attention for its potential applications in drug discovery and the development of proteasome-modulating therapies. By investigating the structure, function, and interaction of USP14 with other cellular components, researchers aim to elucidate its role in ubiquitin-proteasome system regulation and its impact on cellular health. This involves recombinant expression and purification techniques to produce active USP14, allowing for in-depth biochemical and biophysical analyses. Therefore, the exploration of USP14 as a therapeutic target may pave the way for novel approaches in treating neurodegenerative disorders and advancing our understanding of protein homeostasis in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US