Analytical Data
-
Gene name
UROS
- Application
-
Alternative Names
UROS；Uroporphyrinogen-III synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10746
-
Expression Region
1-265aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKVLLLKDAKEDDCGQDPYIRELGLYGLEA TLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLEQNNKT EVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYIC SRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHPGIQGNL NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTAR ALAAQGLPVSCTAESPTPQALATGIRKALQPHGCC
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UROS (urochrome synthase) is an important enzyme involved in heme metabolism, specifically in the biosynthesis of bilirubin from biliverdin. Its role is critical as it balances the degradation of heme, which can lead to toxic effects if not properly regulated. Research into recombinant UROS proteins has gained momentum due to their potential applications in medical biotechnology and therapeutic interventions. Abnormalities in UROS activity are linked to various diseases, including certain types of jaundice and other heme-related disorders. By producing UROS as a recombinant protein, researchers can investigate its structure, function, and interactions in detail, facilitating the development of diagnostic tools and treatments for related conditions. Furthermore, recombinant UROS can serve as a model for understanding the dynamics of heme metabolism and its regulation and may offer insights into potential drug design targeting heme-related pathways. As we advance our understanding of UROS through molecular biology techniques, we enable the exploration of novel approaches to treat and manage diseases associated with heme metabolism, thus underscoring the importance of this enzyme in both basic science and clinical applications.
