Analytical Data
-
Gene name
ATE1
- Application
-
Alternative Names
AI225793; Arginine tRNA Protein transferase 1; Arginine-tRNA--Protein transferase 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95260
-
Expression Region
1-518aa
-
AA Sequence
MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFEDPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN
-
Molecular Weight
83.38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATE1 (Aminoacyl-tRNA Enterase 1) is an essential enzyme involved in the post-translational modification of proteins. It catalyzes the addition of aminoacyl groups to specific tRNA molecules, facilitating the correct incorporation of amino acids into nascent polypeptide chains during translation. The AT1 protein plays a critical role in cellular stress responses, particularly in the stress granule formation and maintenance, which are crucial for cell survival under adverse conditions. Research has shown that ATE1 is implicated in various cellular processes, including gene expression regulation, protein quality control, and apoptosis. Mutations or dysregulation of ATE1 have been linked to several diseases, including neurodegenerative disorders and cancer. As such, understanding the structure and function of ATE1, as well as its interactions with other cellular components, is vital for uncovering the molecular mechanisms underlying these conditions and for developing potential therapeutic strategies. The study of ATE1-recombinant proteins has emerged as a powerful approach to investigate its enzymatic activity and regulatory mechanisms in detail, enabling researchers to elucidate its roles in health and disease, and offering insights into potential avenues for drug development or intervention in related disorders.
