Analytical Data
-
Gene name
UPK3A
- Application
-
Alternative Names
UPK3A；UPK3；Uroplakin-3a
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75631
-
Expression Region
19-207aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALE KPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTE GGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCL WDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UPK3A (Uroplakin 3A) is a member of the uroplakin family, which are integral membrane proteins predominantly expressed in the transitional epithelium of the urinary tract. This protein plays a crucial role in forming the apical plaque of urothelial cells, which serves as a barrier to prevent toxic substances in urine from penetrating the underlying tissue. Research indicates that UPK3A is involved in key physiological processes such as cell adhesion, signal transduction, and the maintenance of urothelial integrity. Abnormal expression of UPK3A has been linked to various urological diseases, including bladder cancer, making it a potential biomarker for diagnosis and prognosis. Furthermore, the exploration of UPK3A as a therapeutic target has gained traction, with studies focusing on its role in tumor progression and metastasis. The recombinant production of UPK3A protein allows for detailed structural and functional analyses, thereby enhancing our understanding of its biological relevance and potential clinical applications. Overall, the study of UPK3A is pivotal not only for elucidating the mechanisms underlying urothelial function but also for developing innovative strategies in the diagnosis and treatment of urinary tract diseases.
