Analytical Data
-
Gene name
DAP6
- Application
-
Alternative Names
DAP6；BING2；DAP6；Death domain-associated Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UER7
-
Expression Region
1-233aa
-
AA Sequence
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLI
-
Molecular Weight
52.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DAP6 protein, a part of the T cell receptor complex, plays a crucial role in immune system signaling and cellular communication. Its function is particularly relevant in the context of antigen presentation and T cell activation, making it a focal point for immunological research. Recent studies have highlighted the importance of DAP6 in various immune responses, particularly in anti-tumor immunity and autoimmune diseases. The potential for DAP6 as a therapeutic target has generated interest, particularly in the development of novel immunotherapies. Researchers are exploring DAP6's structural characteristics and interactions with other proteins, as well as its role in modulating immune responses. Understanding the mechanisms by which DAP6 operates can lead to insights into enhancing vaccine efficacy and improving treatments for immune-related conditions. Furthermore, the exploration of DAP6 in diverse contexts, such as its involvement in dendritic cell function and its impact on T cell differentiation, positions it as a promising candidate for future therapeutic strategies in the field of immunology. Through the development of DAP6 recombinant proteins, scientists aim to further elucidate its biological functions and therapeutic potentials.
