Analytical Data
-
Gene name
ASXL1
- Application
-
Alternative Names
ASXL1; ASXL1_HUMAN; KIAA0978; Putative Polycomb group Protein ASXL1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXJ9
-
Expression Region
1-84aa
-
AA Sequence
MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
-
Molecular Weight
35.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASXL1 (Additional Sex Combs-Like 1) is a crucial gene that encodes a protein involved in chromatin remodeling and gene regulation, playing an essential role in hematopoiesis and developmental processes. Mutations or dysregulation of ASXL1 have been implicated in various hematological malignancies, particularly acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS). Research into ASXL1 recombinant protein has gained traction as scientists aim to elucidate its functional mechanisms in both normal and pathological contexts. Studies have demonstrated that ASXL1 interacts with key regulatory proteins and modulates transcriptional networks, making it a potential target for therapeutic intervention. Understanding the structure and function of ASXL1 is critical for developing targeted treatments for ASXL1-related cancers, as well as for furthering our knowledge of epigenetic regulation in normal and malignant hematopoiesis. Advances in recombinant protein technology also enable the production and characterization of ASXL1, facilitating investigations into its biological roles and interactions. As a result, ASXL1 serves not only as a biomarker for certain blood disorders but also as a promising avenue for innovative therapeutic strategies in oncology.
