Analytical Data
-
Gene name
ASH1L
- Application
-
Alternative Names
ASH1L; ASH1L_HUMAN; ASH1L1; FLJ10504; huASH1; KIAA1420
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR48
-
Expression Region
2859-2967aa
-
AA Sequence
MHHHHHHEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKN ADYYEKISD PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGR KSPVGRDVCRLRKAYYNAR HEASAQ
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASH1L (ASH1 Like) is a member of the myosins superfamily and functions as a histone methyltransferase, specifically involved in regulating gene expression through chromatin modification. Its role in epigenetics has garnered significant attention due to its implications in various biological processes, including development, differentiation, and disease. Research suggests that ASH1L is crucial for maintaining the balance between active and repressive chromatin states, influencing the transcription of target genes. Genetic mutations or dysregulation of ASH1L have been associated with several diseases, including certain types of cancer, highlighting its importance as a potential therapeutic target. Additionally, its interactions with other proteins involved in the epigenetic landscape make ASH1L a key player in understanding complex regulatory networks. Studies have also explored ASH1L's role in stem cell biology and its impact on cellular differentiation and identity. The investigation of ASH1L-recombinant proteins has advanced our understanding of its functional mechanisms and regulatory pathways, potentially leading to innovative strategies for disease intervention and personalized medicine. Overall, ASH1L represents an important focus in the field of epigenetics, and ongoing research continues to unveil its diverse roles and therapeutic potential.











