Analytical Data
-
Gene name
PDGFBB
- Application
-
Alternative Names
PDGFBB; PDGF-BB
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01127
-
Expression Region
82-190 aa
-
AA Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
-
Molecular Weight
12.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Platelet-Derived Growth Factor BB (PDGF-BB) is a key protein involved in various cellular processes, including cell proliferation, migration, and angiogenesis. It plays a significant role in wound healing, tissue repair, and the development of connective tissues. PDGF-BB functions by binding to its specific receptor, PDGFR-β, which is predominantly expressed in connective tissues, smooth muscle cells, and endothelial cells. Dysregulation of PDGF-BB signaling has been implicated in several pathological conditions, including fibrosis, atherosclerosis, and various cancers. Consequently, understanding the mechanisms of PDGF-BB action is crucial for developing targeted therapies. Recent advancements in recombinant protein technology have enabled the production of PDGF-BB, facilitating extensive research into its biological functions and therapeutic potential. Studies have reported its promising effects in regenerative medicine, particularly in enhancing tissue regeneration and promoting healing in chronic wounds and bone defects. Furthermore, PDGF-BB's role in enhancing angiogenesis makes it a candidate for applications in ischemic diseases. As research progresses, PDGF-BB continues to be a focus of interest in cellular biology, with the aim of leveraging its capabilities to develop novel treatments for a range of diseases. The exploration of PDGF-BB's functions not only enhances our understanding of fundamental biological processes but also opens avenues for innovative therapeutic strategies that harness its regenerative properties.
