Analytical Data
-
Gene name
UBL5
- Application
-
Alternative Names
UBL5;Ubiquitin-like Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZL1
-
Expression Region
1-73aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKL IAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBL5 (Ubiquitin-like protein 5) is a member of the ubiquitin-like protein family, which plays a crucial role in various cellular processes, including protein degradation, signal transduction, and cellular stress responses. Research on UBL5 has gained momentum due to its potential involvement in regulating the ubiquitin-proteasome system, which is essential for maintaining protein homeostasis and cellular function. Recent studies suggest that UBL5 may modulate protein stability and degradation pathways, influencing diverse biological functions and pathways, such as cell cycle regulation, apoptosis, and responses to oxidative stress. Additionally, alterations in UBL5 expression and function have been implicated in various diseases, including cancer and neurodegenerative disorders. Understanding the structural and functional characteristics of UBL5 is critical for elucidating its specific roles in cellular mechanisms and for exploring its potential as a therapeutic target. Consequently, researchers are increasingly focused on characterizing UBL5 through recombinant protein expression and purification, aimed at determining its interaction partners, post-translational modifications, and overall functional implications within the ubiquitin-like protein landscape. This research not only enhances our knowledge of UBL5's biological roles but also paves the way for developing novel strategies to manipulate UBL5-mediated pathways for therapeutic interventions in diseases associated with protein misregulation.











