Cat: PA1000-3386

Recombinant Human UBE2Z Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBE2Z

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBE2Z;Ubiquitin-conjugating enzyme E2 Z

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H832

  • Expression Region

    109-354aa

  • AA Sequence

    MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDY PIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISS VLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMME GKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHF DYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBE2Z is an essential member of the ubiquitin-conjugating enzyme family, playing a crucial role in the ubiquitin-proteasome system, which regulates protein degradation and homeostasis in cells. This enzyme is involved in the post-translational modification of proteins through ubiquitination, a process that tags substrates for degradation or alters their cellular functions. Dysregulation of UBE2Z has been implicated in various diseases, including cancers and neurodegenerative disorders, highlighting its significance in maintaining cellular health. Recent research has focused on the structural and functional characterization of UBE2Z, elucidating the mechanism by which it interacts with E3 ligases and specific substrates. Furthermore, studies have demonstrated its potential as a therapeutic target, as modulating UBE2Z activity may provide novel strategies for treating diseases associated with aberrant protein degradation. Understanding the intricacies of UBE2Z's role in ubiquitination pathways not only sheds light on fundamental cellular processes but also opens new avenues for drug development and disease intervention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US