Analytical Data
-
Gene name
UBE2Z
- Application
-
Alternative Names
UBE2Z；Ubiquitin-conjugating enzyme E2 Z
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H832
-
Expression Region
109-354aa
-
AA Sequence
MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDY PIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISS VLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMME GKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHF DYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2Z is an essential member of the ubiquitin-conjugating enzyme family, playing a crucial role in the ubiquitin-proteasome system, which regulates protein degradation and homeostasis in cells. This enzyme is involved in the post-translational modification of proteins through ubiquitination, a process that tags substrates for degradation or alters their cellular functions. Dysregulation of UBE2Z has been implicated in various diseases, including cancers and neurodegenerative disorders, highlighting its significance in maintaining cellular health. Recent research has focused on the structural and functional characterization of UBE2Z, elucidating the mechanism by which it interacts with E3 ligases and specific substrates. Furthermore, studies have demonstrated its potential as a therapeutic target, as modulating UBE2Z activity may provide novel strategies for treating diseases associated with aberrant protein degradation. Understanding the intricacies of UBE2Z's role in ubiquitination pathways not only sheds light on fundamental cellular processes but also opens new avenues for drug development and disease intervention.
