Analytical Data
-
Gene name
BETVIA
- Application
-
Alternative Names
BETVIA；BETVI；Major pollen allergen Bet v 1-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15494
-
Expression Region
1-160aa
-
AA Sequence
MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
-
Molecular Weight
17.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BETVIA, a recombinant protein derived from the virus Betula virus 1, represents a significant advance in the field of biotechnology and virology. The background of its research lies in an increasing need for innovative therapeutic agents and vaccines, particularly in combating viral diseases. Recombinant proteins, such as BETVIA, are engineered through genetic manipulation to harness specific biological functions, enabling more effective treatments with reduced side effects. The study of BETVIA focuses on its ability to elicit robust immune responses, which is critical for the development of vaccines targeting various viral pathogens. Additionally, the research explores its potential applications in immunotherapy, offering insights into how it can modulate immune responses for enhanced disease resistance. Scientists are also investigating the structural and functional characteristics of BETVIA to optimize its efficacy. The findings from this research could pave the way for novel interventions against viral infections, addressing public health challenges worldwide. The ongoing exploration of BETVIA not only aims to broaden the therapeutic arsenal against existing viral threats but also to prepare for emerging viral diseases, highlighting the importance of recombinant proteins in modern medicine.
