Analytical Data
-
Gene name
PC-LKC
- Application
-
Alternative Names
CDHR2; PCDH24; PCLKCCadherin-related family member 2; Protocadherin LKC; PC-LKC; Protocadherin-24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYE9
-
Expression Region
210-318 aa
-
AA Sequence
GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PC-LKC is a recombinant protein that has gained attention in scientific research due to its potential applications in therapeutic and diagnostic contexts. This protein is derived from the LCK gene, which encodes a member of the Src family of tyrosine kinases, essential for lymphocyte development and activation. Understanding the role of PC-LKC is crucial as it may provide insights into various immune responses and signal transduction pathways. Researchers have been focused on studying PC-LKC's structure, function, and interaction with other molecules to elucidate its role in cellular processes. Additionally, the recombinant production of PC-LKC allows for large-scale studies and potential therapeutic applications, including the development of targeted treatments for lymphocyte-related disorders such as autoimmune diseases and cancers. The manipulation of this protein in laboratory settings has opened new avenues for drug discovery and biomarker identification, highlighting its significance in both basic biology and applied medical research. Overall, the investigation of PC-LKC as a recombinant protein represents a promising frontier in understanding complex biological systems and developing innovative medical interventions.
