Cat: PA1000-3371

Recombinant Human UBE2F Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBE2F

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBE2F;NCE2;NEDD8-conjugating enzyme UBE2F

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969M7

  • Expression Region

    1-185aa

  • AA Sequence

    MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC TCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKC LTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDL LNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBE2F, a member of the ubiquitin-conjugating enzyme family, is crucial for the regulation of protein degradation and cellular signaling through the ubiquitin-proteasome system. Its role as a ubiquitin transferase has garnered attention due to its involvement in various cellular processes, including DNA repair, cell cycle regulation, and apoptosis. Research indicates that UBE2F may contribute to the regulation of specific substrates critical for maintaining cellular homeostasis. Alterations in UBE2F expression and function have been linked to several diseases, including cancer, where abnormal ubiquitination pathways can lead to uncontrolled cell growth and survival. Consequently, studying UBE2F and its mechanisms has implications for therapeutic strategies, particularly in oncology. The recombinant expression of UBE2F protein provides a valuable tool for elucidating its biochemical properties, interactions with E3 ligases, and substrate specificity. Investigating UBE2F at the molecular level aids in understanding its contribution to cellular homeostasis and disease states, laying the groundwork for potential interventions targeting the ubiquitin-proteasome pathway.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US