Analytical Data
-
Gene name
UBE2F
- Application
-
Alternative Names
UBE2F;NCE2;NEDD8-conjugating enzyme UBE2F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969M7
-
Expression Region
1-185aa
-
AA Sequence
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC TCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKC LTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDL LNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBE2F, a member of the ubiquitin-conjugating enzyme family, is crucial for the regulation of protein degradation and cellular signaling through the ubiquitin-proteasome system. Its role as a ubiquitin transferase has garnered attention due to its involvement in various cellular processes, including DNA repair, cell cycle regulation, and apoptosis. Research indicates that UBE2F may contribute to the regulation of specific substrates critical for maintaining cellular homeostasis. Alterations in UBE2F expression and function have been linked to several diseases, including cancer, where abnormal ubiquitination pathways can lead to uncontrolled cell growth and survival. Consequently, studying UBE2F and its mechanisms has implications for therapeutic strategies, particularly in oncology. The recombinant expression of UBE2F protein provides a valuable tool for elucidating its biochemical properties, interactions with E3 ligases, and substrate specificity. Investigating UBE2F at the molecular level aids in understanding its contribution to cellular homeostasis and disease states, laying the groundwork for potential interventions targeting the ubiquitin-proteasome pathway.











