Cat: PA2000-1517

Recombinant Human ATP5a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATP5a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATP5a;ATP5A;ATP5A1;ATP5AL2;ATP synthase subunit alpha. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25705

  • Expression Region

    44-553aa

  • AA Sequence

    QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAE EMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVG EELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGI KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLY CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSG CSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY LHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQI FLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREV AAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVR GYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEI VTNFLAGFEA

  • Molecular Weight

    71 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATP5a, a crucial subunit of the ATP synthase complex in mitochondria, plays a vital role in cellular energy production through oxidative phosphorylation. Research has increasingly focused on ATP5a due to its implication in various diseases, including neurodegenerative disorders and metabolic syndromes. The ATP5a protein helps facilitate the conversion of ADP and inorganic phosphate to ATP, the primary energy currency of the cell, making it essential for numerous biological processes. In recent years, recombinant ATP5a has been produced to study its structure and function, allowing scientists to investigate its interactions within the ATP synthase complex and its regulatory mechanisms. The recombinant protein serves as a valuable tool for understanding mitochondrial dysfunction and its contribution to pathophysiological conditions. Furthermore, studies on ATP5a have provided insights into potential therapeutic targets for enhancing mitochondrial function and improving energy metabolism in affected cells. As research progresses, the exploration of ATP5a's role in cellular bioenergetics continues to reveal critical information about mitochondrial biology and its broader implications in health and disease. The generation of recombinant ATP5a not only aids in elucidating the underlying mechanisms of mitochondrial disorders but also paves the way for innovative therapeutic strategies aimed at enhancing cellular energy production and restoring normal mitochondrial function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US