Analytical Data
-
Gene name
TTC33
- Application
-
Alternative Names
TTC33；Tetratricopeptide repeat Protein 33
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PID6
-
Expression Region
1-262aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMASFGWKRKIGEKVSKVTSQQFEAEAA DEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLAENKRYRE AIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSW ESWQTLGRAQLGLGEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQ QKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKEKTVSA NKTMVIVSASGAIETVTEKEDGATPPDGSVFIKAR
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TTC33, or Tetratricopeptide Repeat Protein 33, is a member of the tetratricopeptide repeat (TPR) protein family, which is characterized by the presence of repeated motifs that facilitate protein-protein interactions. It has garnered attention in recent years due to its involvement in various cellular processes, including cell signaling, protein folding, and stress responses. Research has indicated that TTC33 may play a significant role in the regulation of apoptosis and the maintenance of cellular homeostasis, potentially linking it to cancer and neurodegenerative diseases. Additionally, TTC33 has been implicated in modulating the activity of key proteins such as p53 and HSF1, further emphasizing its importance in cellular regulation. The investigation into TTC33, particularly the characterization of its recombinant forms, has significant implications for understanding its functional roles in various biological contexts. By producing and studying recombinant TTC33, researchers aim to elucidate its molecular mechanisms and therapeutic potential, paving the way for novel approaches in the treatment of diseases where TTC33 is implicated. Consequently, the study of TTC33 is crucial for advancing our knowledge of protein interactions and their effects on human health, making it a target of interest in both biochemical and biomedical research.
