Cat: PA1000-3325

Recombinant Human TUBB3 Protein,his+sumo

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TUBB3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TUBB3;TUBB4;Tubulin beta-3 chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    his+sumo tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13509

  • Expression Region

    1-450aa

  • AA Sequence

    MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVY YNGASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNN WAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTL LISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETY CIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADL RKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTG EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TUBB3, or Tubulin Beta 3, is a member of the tubulin family that plays a critical role in microtubule dynamics and cellular functions, particularly in neurons. Research into TUBB3 has garnered significant attention due to its involvement in various neurological disorders and cancers. Mutations or aberrant expression of TUBB3 have been implicated in conditions such as neurodegenerative diseases and certain types of tumors, making it a valuable target for therapeutic intervention. The study of TUBB3 recombinant proteins allows for a deeper understanding of its structural and functional properties, facilitating investigations into its role in microtubule assembly and stability. Moreover, recombinant TUBB3 proteins serve as vital tools in the development of diagnostic assays and potential drug candidates aimed at modulating microtubule dynamics in disease. As we continue to unravel the complexities of TUBB3, its significance in both basic biology and clinical applications is becoming increasingly evident, paving the way for innovative approaches to treat disorders associated with microtubule dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US