Analytical Data
-
Gene name
TSTA3
- Application
-
Alternative Names
TSTA3；SDR4E1；GDP-L-fucose synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13630
-
Expression Region
1-321aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGEPQGSMRILVTGGSGLVGKAIQKVVADG AGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNI KYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETM IHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNF NIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWV LREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSTA3, or T cell specific transmembrane protein 3, has garnered attention in immunological research due to its crucial role in T cell development and function. Discovered as a membrane protein expressed predominantly in T cells, TSTA3 is believed to be involved in various cellular processes, including T cell activation, proliferation, and differentiation. Its unique expression pattern signifies potential regulatory functions that could influence immune responses. In recent years, investigations have focused on understanding the molecular mechanisms through which TSTA3 operates, as well as its interactions with other signaling molecules and its impact on T cell-mediated immunity. Additionally, research has explored the therapeutic implications of TSTA3 in autoimmune diseases, cancer, and other conditions where T cell activity plays a pivotal role. By employing advanced techniques such as recombinant protein expression and functional assays, studies aim to elucidate the precise functions of TSTA3 and assess its potential as a biomarker or therapeutic target. Given the increasing incidence of immune-related disorders, understanding TSTA3's role may provide valuable insights into novel treatment strategies and enhance our comprehension of T cell biology. As the scientific community continues to dissect the complex interplay of immune regulation, TSTA3 stands out as a promising candidate for further exploration.
