Analytical Data
-
Gene name
IFITM2
- Application
-
Alternative Names
IFITM2；Interferon-induced transmembrane Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01629
-
Expression Region
1-132aa
-
AA Sequence
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR
-
Molecular Weight
14.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFITM2 (Interferon-Inducible Transmembrane Protein 2) is a member of the IFITM family, which plays a critical role in the innate immune response to viral infections. Discovered as an interferon-stimulated gene, IFITM2 is known for its ability to restrict the entry of various enveloped viruses, including influenza, HIV, and West Nile virus, into host cells. This restriction occurs at the level of viral membrane fusion, highlighting the protein’s function as a crucial barrier against viral propagation. Research into IFITM2 has expanded to explore its regulatory mechanisms, cellular localization, and potential therapeutic applications, particularly in enhancing antiviral strategies. Furthermore, the understanding of IFITM2's interactions with host cell factors and its role in immune signaling pathways may provide insights into the development of immune-based treatments. As viral pathogens evolve and develop resistance to traditional antiviral drugs, elucidating the mechanisms by which IFITM2 mediates its antiviral effects is of significant scientific interest, potentially paving the way for novel interventions in viral diseases. Therefore, recombinant IFITM2 protein has become a valuable tool for study, allowing researchers to investigate its structure-function relationships, assess its effectiveness in different viral contexts, and develop potential therapeutic applications to combat viral infections in an era of emerging and re-emerging viral threats.
