Cat: PA1000-3317

Recombinant Human TSSK6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TSSK6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TSSK6;SSTK;Testis-specific serine/threonine-Protein kinase 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXA6

  • Expression Region

    1-273aa

  • AA Sequence

    MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPP DFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQA VQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRV KLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGV VLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQF SPSARPSAGQVARNCWLRAGDSG

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TSSK6 (testis-specific serine kinase 6) is a member of the testis-specific serine/threonine kinase family, which plays a crucial role in sperm maturation and male fertility. It is predominantly expressed in the testes, suggesting its significant involvement in spermatogenesis and spermiogenesis. Recent studies have implicated TSSK6 in various reproductive disorders, highlighting its potential as a biomarker for male infertility. Research indicates that TSSK6 is essential for the structural integrity and function of sperm, as it participates in the phosphorylation of specific substrates critical for sperm development. Moreover, disruptions in TSSK6 expression or function have been associated with abnormal sperm morphology and motility, further affecting fertility. Given the rising prevalence of male infertility in clinical settings, understanding the mechanisms by which TSSK6 operates is imperative for developing novel therapeutic strategies. The recombinant expression of TSSK6 protein in various cellular systems offers an opportunity to investigate its biochemical properties, elucidate its signaling pathways, and assess its interactions with other proteins involved in sperm maturation. By utilizing advanced techniques such as mass spectrometry and protein crystallography, researchers can gain insights into the functional domains of TSSK6, potentially paving the way for targeted interventions in male reproductive health. Overall, the study of TSSK6 presents a promising avenue in reproductive biology, with implications for both diagnostic and therapeutic advancements in treating male infertility.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US