Analytical Data
-
Gene name
PASK
- Application
-
Alternative Names
DKFZP434O051; DKFZp686P2031; hPASK; KIAA0135; MGC93882; mKIAA0135; PAS domain containing serine/threonine kinase; PAS domain containing serine/threonine protein kinase; PAS domain-containing serine/threonine-protein kinase; PAS kinase; PAS serine/threonine kinase; PAS-kinase; Pask; PASK_HUMAN; PASKIN; STK 37; STK37
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RG2
-
Expression Region
1-100 aa
-
AA Sequence
MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PASK (PasKal) is a protein involved in various cellular processes, primarily functioning as a serine/threonine kinase. It plays a significant role in cellular signaling pathways, particularly in regulating glucose metabolism and energy homeostasis. Understanding PASK's functions and mechanisms is crucial, as dysregulation of its activity has been linked to numerous metabolic disorders, including diabetes and obesity. The study of PASK has gained traction due to its potential as a therapeutic target for these diseases, highlighting the importance of developing recombinant PASK proteins for in-depth biochemical and physiological studies. Researchers aim to characterize PASK's structure and function through recombinant protein expression, allowing the exploration of its interactions with other cellular proteins and elucidation of its role in metabolic pathways. Furthermore, recombinant PASK proteins can serve as valuable tools for drug discovery and the development of novel therapeutic strategies aimed at correcting metabolic dysfunction. This research not only enhances our understanding of PASK’s biological significance but also paves the way for innovative treatments that could improve health outcomes in patients with metabolic disorders.
