Analytical Data
-
Gene name
TSR2
- Application
-
Alternative Names
TSR2;Pre-rRNA-processing Protein TSR2 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969E8
-
Expression Region
1-190aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAGAAEDARALFRAGVCAALEAWPALQ IAVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEF DTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATAL KTARETDEDDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEED IVEDGWTIVRRK
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSR2 (Tumor Suppressor Response 2) is a pivotal gene implicated in various cellular processes, including cell cycle regulation and apoptosis. Research on TSR2 has gained momentum due to its proposed role in tumor suppression and its potential implications in cancer biology. Initially identified in a search for genes that are downregulated in certain cancer types, TSR2 has been observed to influence key signaling pathways associated with cell growth and differentiation. Understanding TSR2’s function at the molecular level has led to the development of recombinant proteins, which serve as critical tools for elucidating its biological roles and mechanisms of action. These recombinant TSR2 proteins are instrumental in exploring the gene's interactions with other cellular molecules, as well as assessing its impact on tumor cell behavior. Furthermore, studies utilizing TSR2 protein in various cellular assays have provided insights into the therapeutic potential of modulating its activity in cancer treatments. As the body of research surrounding TSR2 expands, it holds promise for revealing novel biomarkers for cancer diagnosis and prognosis, as well as innovative therapeutic strategies aimed at leveraging its tumor-suppressive properties.











