Cat: PA1000-3285

Recombinant Human TRAF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TRAF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TRAF1;EBI6;TNF receptor-associated factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13077

  • Expression Region

    1-416aa

  • AA Sequence

    MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGE DQICPKCRGEDLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGS PQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQL QAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENI VAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQAL GKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLL DQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAY VKDDTMFLKCIVETST

  • Molecular Weight

    74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TRAF1 (TNF Receptor Associated Factor 1) is a member of the TRAF protein family, which plays a crucial role in the signaling pathways of various receptors, particularly in the immune response and inflammation. Research has indicated that TRAF1 is involved in mediating signals from tumor necrosis factor (TNF) receptors, interleukin receptors, and other related cytokine receptors, thereby influencing cellular processes such as survival, proliferation, and differentiation. Its expression has been linked to various diseases, including autoimmune disorders and cancer, making it a significant focus of study for therapeutic interventions. Moreover, TRAF1's interaction with other signaling proteins highlights its potential as a regulatory hub within the immune system. Recombinant TRAF1 protein studies provide insights into its structural and functional properties, enhancing our understanding of its role in inflammatory processes and disease pathogenesis. As researchers explore TRAF1's mechanisms of action, they aim to develop novel strategies for modulating its activity, which could lead to new treatments for inflammation-related diseases and cancer. Overall, TRAF1 represents a compelling target for further investigation, given its multifaceted involvement in immune regulation and its potential implications in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US