Analytical Data
-
Gene name
TPX
- Application
-
Alternative Names
TPX；Targeting Protein for Xklp2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A862
-
Expression Region
1-168aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTL VAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVV LCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGL AARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPX (targeting protein for Xklp2) is a crucial co-factor that plays a significant role in the process of microtubule nucleation and stabilization during cell division. It is primarily involved in the assembly of the mitotic spindle, which is essential for accurate chromosome segregation. Research into TPX has gained increasing attention due to its implications in cancer biology, as aberrations in its function can lead to chromosomal instability and tumorigenesis. Its interaction with the motor protein Xklp2 highlights a complex regulatory mechanism that is fundamental for maintaining proper cell cycle dynamics. Understanding TPX's structural properties and its interactions at the molecular level may provide insights into novel therapeutic targets for cancer treatment. Additionally, TPX has emerged as a potential biomarker for certain cancer types, further emphasizing the need for comprehensive studies on its behavior and regulatory mechanisms in various cellular contexts. The ongoing research aims to elucidate the precise molecular pathways involving TPX, which could pave the way for innovative strategies in cancer therapy and improve our understanding of microtubule dynamics in cellular processes.
