Analytical Data
-
Gene name
TPMT
- Application
-
Alternative Names
TPMT；Thiopurine S-methyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51580
-
Expression Region
4-244aa
-
AA Sequence
TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE
-
Molecular Weight
54.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPMT (thiopurine S-methyltransferase) is an important enzyme involved in the metabolism of thiopurine drugs, commonly used in the treatment of various autoimmune diseases and malignancies. The research surrounding TPMT has gained significant attention due to its influence on drug efficacy and safety, as variations in TPMT gene expression can lead to differences in enzyme activity among individuals. Genetic polymorphisms in the TPMT gene can be classified into high, intermediate, and low activity alleles, which directly affect a patient's response to thiopurine therapy. Patients with low or intermediate TPMT activity are at increased risk for drug toxicity, while those with high activity may experience suboptimal therapeutic effects. As a result, understanding TPMT's structure and function is crucial for optimizing individualized treatment regimens and minimizing adverse drug reactions. Recombinant TPMT proteins have been produced for further study to investigate their biochemical properties, substrate specificity, and interaction with various thiopurine compounds. This research not only enhances the understanding of TPMT's role in drug metabolism but also opens avenues for developing personalized medicine strategies that can improve patient outcomes in thiopurine treatment.
