Analytical Data
-
Gene name
EP4
- Application
-
Alternative Names
EP4；PTGER2；Prostaglandin E2 receptor EP4 subtype
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43116
-
Expression Region
1-358aa
-
AA Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
-
Molecular Weight
39.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EP4 (Prostaglandin E4 receptor) is a member of the G protein-coupled receptor (GPCR) family that plays a critical role in various physiological and pathological processes, including inflammation, pain response, and immune regulation. Recent studies have shown that EP4 is involved in mediating the effects of prostaglandin E2 (PGE2), which is a key lipid mediator in inflammatory responses. Given its significant role in modulating immune responses, EP4 has gained attention as a potential therapeutic target for various diseases, including cancer, where its overexpression has been linked to tumor growth and progression. The exploration of EP4 recombinant proteins is crucial for understanding its structure-function relationship and for developing selective modulators that can act as pharmacological agents. These recombinant proteins serve as valuable tools for studying EP4 signaling pathways in vitro and in vivo, enabling researchers to dissect the mechanisms of action and identify potential drug candidates. Additionally, characterizing EP4's interactions with other proteins and cellular components can provide insights into its role in diverse biological contexts. Overall, the research on EP4 recombinant proteins is vital for advancing our understanding of GPCR biology and for the development of innovative therapeutic strategies targeting EP4 in various diseases.
