Analytical Data
-
Gene name
ARFGEF1
- Application
-
Alternative Names
ARFGEF1; ARFGEP1; BIG1Brefeldin A-inhibited guanine nucleotide-exchange Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6D6
-
Expression Region
311-411aa
-
AA Sequence
EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP
-
Molecular Weight
36.85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARFGEF1, also known as ADP-ribosylation factor guanine nucleotide exchange factor 1, plays a crucial role in membrane traffic and intracellular transport processes. It is involved in the activation of ADP-ribosylation factors (ARFs), which are small GTPases that were initially identified for their role in vesicle budding from the Golgi apparatus. Dysfunction in ARFGEF1 has been linked to various diseases, including cancer and neurodegenerative disorders, highlighting its significance in cellular signaling and homeostasis. Moreover, recent studies have suggested that ARFGEF1 may also participate in regulating the cytoskeletal dynamics and endocytosis, making it an attractive target for therapeutic interventions. The understanding of its function at the molecular level, including its interactions with other proteins and membranes, is essential for elucidating its contributions to cellular mechanisms. As research continues, a deeper insight into ARFGEF1 could unveil novel strategies for disease modulation and provide a clearer picture of its role in cellular physiology. This underscores the need for further exploration of ARFGEF1 through various methodologies, including recombinant protein expression, structural analysis, and functional assays, to clarify its complex biological roles and therapeutic potential.
