Cat: PA1000-3259

Recombinant Human TOLLIP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TOLLIP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TOLLIP;Toll-interacting Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H0E2

  • Expression Region

    2-274aa

  • AA Sequence

    MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG TVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRW NKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDK WYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYV PITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIR SVLEAQRGNK DAAINSLLQMGEEPVEHHHHHH

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TOLLIP (Toll-interacting protein) is a key regulator in the immune response, particularly in the context of Toll-like receptor (TLR) signaling pathways. The role of TOLLIP has gained prominence in recent years due to its involvement in mediating inflammatory responses and its potential implications in various diseases, such as autoimmune disorders, sepsis, and cancer. Research has indicated that TOLLIP functions as a negative regulator, modulating the activity of TLRs and downstream signaling mechanisms to prevent excessive inflammation. Given the increasing prevalence of inflammatory diseases, the potential for TOLLIP as a therapeutic target has motivated extensive studies focusing on its structure, function, and interactions with other proteins involved in the immune response. Understanding TOLLIP’s role could pave the way for innovative treatments aimed at controlling inflammation and improving outcomes in patients suffering from TLR-related pathologies. The characterization of TOLLIP through recombinant protein expression techniques has been instrumental, enabling detailed studies of its biochemical properties and functional assays that are critical for deciphering its regulatory mechanisms. This research not only contributes to our understanding of the innate immune system but also opens new avenues for drug development and therapeutic interventions tailored to modulate inflammation through TOLLIP pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US