Analytical Data
-
Gene name
TOLLIP
- Application
-
Alternative Names
TOLLIP;Toll-interacting Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0E2
-
Expression Region
2-274aa
-
AA Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG TVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRW NKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDK WYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYV PITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIR SVLEAQRGNK DAAINSLLQMGEEPVEHHHHHH
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TOLLIP (Toll-interacting protein) is a key regulator in the immune response, particularly in the context of Toll-like receptor (TLR) signaling pathways. The role of TOLLIP has gained prominence in recent years due to its involvement in mediating inflammatory responses and its potential implications in various diseases, such as autoimmune disorders, sepsis, and cancer. Research has indicated that TOLLIP functions as a negative regulator, modulating the activity of TLRs and downstream signaling mechanisms to prevent excessive inflammation. Given the increasing prevalence of inflammatory diseases, the potential for TOLLIP as a therapeutic target has motivated extensive studies focusing on its structure, function, and interactions with other proteins involved in the immune response. Understanding TOLLIP’s role could pave the way for innovative treatments aimed at controlling inflammation and improving outcomes in patients suffering from TLR-related pathologies. The characterization of TOLLIP through recombinant protein expression techniques has been instrumental, enabling detailed studies of its biochemical properties and functional assays that are critical for deciphering its regulatory mechanisms. This research not only contributes to our understanding of the innate immune system but also opens new avenues for drug development and therapeutic interventions tailored to modulate inflammation through TOLLIP pathways.











