Cat: PA1000-3256

Recombinant Human TNNC1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNNC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNNC1;TNNC;Troponin C. slow skeletal and cardiac muscles

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63316

  • Expression Region

    1-161aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDDIYKAAVEQLTEEQKNEFKAAFDIFVLG AEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITE DDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The TNNC1 gene encodes the troponin C protein, a crucial component of the cardiac and skeletal muscle contraction apparatus. Research on TNNC1 recombinant protein is driven by its significant role in muscle physiology and its implications in various myopathies and heart diseases. Troponin C binds calcium ions, facilitating the conformational changes necessary for muscle contraction. Mutations in TNNC1 have been linked to familial hypertrophic cardiomyopathy (HCM), which can lead to severe cardiac conditions. The study of recombinant TNNC1 protein allows researchers to better understand the structure-function relationships of this protein, investigate the molecular mechanisms underlying muscle contraction, and explore potential therapeutic interventions for muscle-related diseases. Additionally, recombinant TNNC1 can be used in biochemical assays to study its interactions with other proteins in the troponin complex, providing insights into how alterations in its function can lead to pathological conditions. Understanding the intricate workings of TNNC1 is essential for the development of targeted therapies for patients suffering from cardiac and skeletal muscle disorders. As such, the exploration of TNNC1 recombinant protein has become an important focus in cardiovascular research, with the potential to pave the way for novel diagnostic tools and treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US