Analytical Data
-
Gene name
APOB48R
- Application
-
Alternative Names
ApolipoProtein B receptor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0VD83
-
Expression Region
71-170aa
-
AA Sequence
RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein B48 receptor (APOB48R) research has garnered significant attention due to its critical role in lipid metabolism and cardiovascular disease. APOB48 is an essential component of chylomicrons, which transport dietary lipids from the intestines to peripheral tissues. The receptor is primarily expressed in hepatocytes and plays a vital role in the uptake of triglyceride-rich particles. Understanding the function and regulation of APOB48R is crucial for elucidating the mechanisms underlying lipid-related disorders, such as hyperlipidemia and atherosclerosis. Recent studies have indicated that alterations in APOB48R expression and function may contribute to the development of metabolic syndrome and cardiovascular diseases. As a result, researchers have been focusing on characterizing the receptor at a molecular level, exploring its interactions with other cellular proteins, and identifying potential therapeutic targets. Recombinant forms of APOB48R have been developed to facilitate these studies, offering insights into receptor dynamics, signaling pathways, and the influence of genetic variations. Continued exploration of APOB48R holds promise for unveiling novel strategies for managing lipid disorders and preventing cardiovascular complications.
