Cat: PAX2000-10047

Recombinant Human ORMDL3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ORMDL3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ORMDL3; ORM1-like protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N138

  • Expression Region

    1-153 aa

  • AA Sequence

    MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

  • Molecular Weight

    17.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ORMDL3, a member of the ORM-related protein family, has garnered significant interest in recent years due to its association with various inflammatory and autoimmune diseases. Initial studies identified ORMDL3 as a critical regulator of airway inflammation, particularly in asthma, where genetic polymorphisms in the ORMDL3 gene have been linked to increased susceptibility. The protein is thought to influence the endoplasmic reticulum stress response and modulate the production of pro-inflammatory cytokines. Furthermore, ORMDL3's role in the regulation of sphingolipid metabolism suggests a connection to cellular signaling pathways that are pivotal in immune responses. Recent research has focused on dissecting the molecular mechanisms underlying ORMDL3's influence on inflammation and its potential as a therapeutic target. Investigating the recombinant form of ORMDL3 allows for a more detailed understanding of its functional properties and interactions with other proteins involved in inflammatory pathways. As scholars continue to uncover the complexities of ORMDL3’s role in disease, its potential for therapeutic intervention could open new avenues for treating asthma and related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US