Analytical Data
-
Gene name
DRD5
- Application
-
Alternative Names
DRD5；DRD1B；DRD1L2；D(1B) dopamine receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21918
-
Expression Region
1-477aa
-
AA Sequence
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dopamine receptor D5 (DRD5) is a member of the dopamine receptor family, specifically belonging to the D1-like receptor group, which also includes DRD1. It plays a critical role in the central nervous system by mediating various physiological functions such as regulation of mood, cognition, and motor control. Research has demonstrated that alterations in DRD5 function are associated with several neuropsychiatric disorders, including schizophrenia, attention deficit hyperactivity disorder (ADHD), and substance use disorders. Given its pivotal role in neurotransmission and behavior, DRD5 has garnered significant interest as a potential target for therapeutic interventions. The study of recombinant DRD5 proteins has become increasingly important in understanding its structure-function relationship, signaling mechanisms, and interaction with other cellular proteins. By utilizing recombinant DNA technology to produce DRD5 in various expression systems, researchers can investigate its pharmacological properties, ligand-binding characteristics, and G-protein coupling efficiency. This knowledge is crucial for the development of selective drugs that can modulate DRD5 activity, offering new avenues for the treatment of dopaminergic dysregulation associated with mental health disorders. Furthermore, the characterization of DRD5 at a molecular level can enhance our understanding of dopaminergic signaling pathways and contribute to the discovery of novel biomarkers for psychological disorders. In summary, the study of DRD5 recombinant proteins not only holds promise for advancing basic neuroscience research but also offers potential therapeutic insights for various psychiatric conditions.
