Analytical Data
-
Gene name
TACR3
- Application
-
Alternative Names
TACR3；NK3R；TAC3R；Neuromedin-K receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29371
-
Expression Region
1-465aa
-
AA Sequence
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
-
Molecular Weight
52.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TACR3, or Tachykinin receptor 3, is a crucial neurokinin receptor that plays a significant role in various physiological processes, including pain perception, neuroinflammation, and reproductive functions. This receptor is primarily activated by tachykinins such as neurokinin B (NKB), which are involved in modulating many central and peripheral nervous system functions. Research into TACR3 has gained prominence due to its potential implications in various diseases, including migraine, schizophrenia, and hypothalamic disorders related to energy homeostasis and reproductive health. The expression and signaling mechanisms of TACR3 remain complex, necessitating the need for recombinant protein studies that can provide deeper insights into its structure and function. The production of TACR3 recombinant proteins allows researchers to investigate its binding affinities, signaling pathways, and interactions with other proteins. Furthermore, understanding TACR3's role in cellular responses can aid in the development of targeted therapies for conditions where this receptor is implicated. As such, research efforts are focused not only on the biochemical characterization of TACR3 but also on its potential as a therapeutic target, underscoring its significance in neurobiology and pharmacology. The exploration of TACR3 through recombinant protein technologies thus represents a promising avenue for advancing our understanding of its biological roles and developing effective interventions in related pathologies.
