Analytical Data
-
Gene name
TIMM8A
- Application
-
Alternative Names
TIMM8A；DDP；Mitochondrial import inner membrane translocase subunit Tim8 A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60220
-
Expression Region
1-97aa
-
AA Sequence
MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDK PGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM8A, a protein associated with the mitochondrial import machinery, has garnered significant interest due to its involvement in mitochondrial function and human disease. This protein plays a critical role in the translocation of proteins into mitochondria, which are essential for cellular energy production and metabolism. Mutations in the TIMM8A gene have been linked to a rare genetic disorder known as Deafness-Dystonia Syndrome (DDS), characterized by auditory processing deficits and movement disorders. Research on TIMM8A not only aims to elucidate its functional mechanisms within the mitochondria but also seeks to understand how its dysfunction contributes to the pathophysiology of DDS and other related disorders. Investigating TIMM8A's structure, interactions, and role in mitochondrial dynamics may provide insights into therapeutic targets for treating mitochondrial diseases. Additionally, as mitochondrial dysfunction is implicated in a range of neurodegenerative disorders, understanding TIMM8A could have broader implications for improving mitochondrial health and developing interventions for these conditions. Thus, TIMM8A serves as a promising focus for both basic research and potential clinical applications in the field of mitochondrial biology and related disorders.
