Analytical Data
-
Gene name
ORC1L
- Application
-
Alternative Names
HSORC1; MmORC1; orc1; ORC1_HUMAN; ORC1L; Origin Recognition Complex 1; Origin recognition complex subunit 1 (yeast homolog) like; Origin recognition complex subunit 1; Origin recognition complex subunit 1 homolog; Origin recognition complex subunit 1 like (S. cerevisia; Origin recognition complex subunit 1 like; Origin recognition complex subunit 1 S. cerevisiae homolog like ; Origin recognition complex. subunit 1 like (yeast); PARC1; Replication control protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13415
-
Expression Region
1-110 aa
-
AA Sequence
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORC1L (Origin Recognition Complex subunit 1-like) is a pivotal component of the origin recognition complex, which plays a crucial role in the initiation of DNA replication in eukaryotic cells. Understanding the function and regulation of ORC1L is essential for elucidating the mechanisms of DNA replication and cellular proliferation. Research has indicated that ORC1L is involved not only in the initiation phase of DNA replication but also in maintaining genomic stability, making it a target of interest in cancer biology. Abnormal regulation or mutations in the ORC1L gene have been linked to various cancers, which underscores the significance of this protein in oncogenesis. Furthermore, ORC1L interacts with other key proteins involved in the DNA replication machinery, and studying its recombinant protein form can provide insights into its structure-function relationships and regulatory mechanisms. This research can enhance our understanding of how disruptions in DNA replication contribute to tumorigenesis and may lead to the development of novel therapeutic strategies targeting ORC1L in cancer treatment. The exploration of ORC1L as a potential biomarker or therapeutic target is a promising avenue in molecular cancer research, paving the way for innovative approaches to combat cancer-related challenges.
