Analytical Data
-
Gene name
OR9I1
- Application
-
Alternative Names
OR9I1; Olfactory receptor 9I1; Olfactory receptor OR11-228
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGQ6
-
Expression Region
1-314 aa
-
AA Sequence
MAKNNLTRVTEFILMGFMDHPKLEIPLFLVFLSFYLVTLLGNVGMIMLIQVDVKLYTPMY FFLSHLSLLDACYTSVITPQILATLATGKTVISYGHCAAQFFLFTICAGTECFLLAVMAY DRYAAIRNPLLYTVAMNPRLCWSLVVGAYVCGVSGAILRTTCTFTLSFCKDNQINFFFCD LPPLLKLACSDTANIEIVIIFFGNFVILANASVILISYLLIIKTILKVKSSGGRAKTFST CASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKDA FRKVARRLQVSLSM
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR9I1 protein, a member of the olfactory receptor gene family, has garnered attention due to its unique role in the human sensory system, particularly in odor detection and neural signaling. This protein is encoded by the OR9I1 gene located on chromosome 14 and is part of a larger group of G-protein coupled receptors (GPCRs) that contribute to the complex mechanisms of smell. Emerging research indicates that OR9I1 may have implications beyond olfaction, including potential roles in neurodevelopment and therapeutic targets for neurological disorders, given its expression in various brain regions. Understanding the structural and functional aspects of OR9I1 is essential, as it could lead to discoveries about the molecular basis of sensory perception and its influence on behavior. Additionally, the study of OR9I1 may provide insights into the evolutionary adaptations of the olfactory system in humans compared to other species. Overall, the investigation of OR9I1 not only enhances our comprehension of sensory biology but also opens avenues for novel biomedical applications and interventions.
