Cat: PA2000-1429

Recombinant Human FAAH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FAAH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FAAH;FAAH1;Fatty-acid amide hydrolase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00519

  • Expression Region

    480-579aa

  • AA Sequence

    DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGD IWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fatty acid amide hydrolase (FAAH) is an enzyme primarily responsible for the catabolism of endogenous signaling lipids, particularly the fatty acid amides, including anandamide. An understanding of FAAH’s biochemical and structural properties is critical due to its significant role in various physiological processes, such as pain modulation, inflammation, and neuroprotection. Dysregulation of FAAH activity has been linked to several disorders, including anxiety, depression, and inflammatory diseases, making it an attractive target for therapeutic intervention. The research on recombinant FAAH proteins focuses on elucidating their structure-function relationships, enzymatic mechanisms, and interactions with lipid substrates and inhibitors. By producing recombinant FAAH in various expression systems, researchers aim to obtain a sufficient quantity of purified enzyme for in-depth biochemical assays and structural studies. Furthermore, studies involving FAAH knockout models and pharmacological inhibitors have underscored the enzyme's potential as a drug target, promoting interest in developing FAAH inhibitors for clinical applications. Overall, the comprehensive understanding of FAAH through recombinant protein studies could pave the way for novel therapeutic strategies aimed at modulating endocannabinoid signaling pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US