Analytical Data
-
Gene name
FAAH
- Application
-
Alternative Names
FAAH;FAAH1;Fatty-acid amide hydrolase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00519
-
Expression Region
480-579aa
-
AA Sequence
DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGD IWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fatty acid amide hydrolase (FAAH) is an enzyme primarily responsible for the catabolism of endogenous signaling lipids, particularly the fatty acid amides, including anandamide. An understanding of FAAH’s biochemical and structural properties is critical due to its significant role in various physiological processes, such as pain modulation, inflammation, and neuroprotection. Dysregulation of FAAH activity has been linked to several disorders, including anxiety, depression, and inflammatory diseases, making it an attractive target for therapeutic intervention. The research on recombinant FAAH proteins focuses on elucidating their structure-function relationships, enzymatic mechanisms, and interactions with lipid substrates and inhibitors. By producing recombinant FAAH in various expression systems, researchers aim to obtain a sufficient quantity of purified enzyme for in-depth biochemical assays and structural studies. Furthermore, studies involving FAAH knockout models and pharmacological inhibitors have underscored the enzyme's potential as a drug target, promoting interest in developing FAAH inhibitors for clinical applications. Overall, the comprehensive understanding of FAAH through recombinant protein studies could pave the way for novel therapeutic strategies aimed at modulating endocannabinoid signaling pathways.











