Analytical Data
-
Gene name
ansA
- Application
-
Alternative Names
ansA; ansB; WS0660L-asparaginase; L-ASNase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A962
-
Expression Region
1-338aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTPDD
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ansA recombinant protein has garnered significant attention due to its role in the biosynthesis of the amino acid L-tryptophan in bacteria. The ansA gene encodes the enzyme anthranilate synthase, which catalyzes the first step of the tryptophan biosynthetic pathway, converting chorismate into anthranilate. This process is crucial not only for understanding bacterial metabolism but also for its implications in biotechnology and medicine. Mutations or variations in the ansA gene can affect bacterial growth and survival, making it a potential target for the development of antimicrobial agents. Additionally, recombinant forms of ansA can be used to produce L-tryptophan, a vital precursor for various pharmaceuticals and nutritional supplements. Research into ansA has also provided insights into enzyme structure and function, revealing the mechanisms of substrate binding and catalysis. By utilizing modern molecular biology techniques, scientists can manipulate the ansA gene to create modified variants with enhanced properties, further expanding its applications. Understanding ansA’s role in tryptophan biosynthesis not only contributes to basic microbiology but also holds promise for industrial applications in the production of amino acids and related compounds.
