Analytical Data
-
Gene name
THRSP
- Application
-
Alternative Names
THRSP；Thyroid hormone-inducible hepatic Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92748
-
Expression Region
1-146aa
-
AA Sequence
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
-
Molecular Weight
43.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
THRSP (Thyroid Hormone Responsive Protein), also known as Spot14, is a protein that plays a significant role in the regulation of lipid metabolism and fatty acid synthesis. Originally identified as a thyroid hormone-responsive gene, THRSP is primarily expressed in adipose tissue and liver, and it has been implicated in energy homeostasis. Its involvement in metabolic processes makes it an important target for research, particularly in the context of obesity and metabolic disorders. Studies have shown that THRSP is regulated by various hormonal signals and nutritional states, suggesting it acts as a sensor of metabolic changes. Furthermore, THRSP can influence the expression of genes associated with lipogenesis and can modulate the action of transcription factors involved in fatty acid metabolism. Given the rising prevalence of metabolic diseases, researchers are increasingly focused on understanding the molecular mechanisms underlying THRSP's functions. This includes exploring its role in energy balance, its potential as a therapeutic target for obesity, and its interactions with other metabolic pathways. Advances in recombinant protein technologies have facilitated the study of THRSP, providing insights into its structure and function. By generating recombinant THRSP, researchers can investigate its biological activity, interactions with other proteins, and effects on metabolic regulation in a controlled environment. Overall, THRSP holds promise as a key player in the understanding and treatment of metabolic diseases, making it a focal point of ongoing biomedical research.
