Analytical Data
-
Gene name
OR8K1
- Application
-
Alternative Names
OR8K1; Olfactory receptor 8K1; Olfactory receptor OR11-182
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGG5
-
Expression Region
1-319 aa
-
AA Sequence
MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN KEVKDALKRTLTNRFKIPI
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR8K1 gene encodes a member of the olfactory receptor family, which plays a critical role in the detection of odorants and sensory perception. Research into OR8K1 recombinant protein has gained significance due to the olfactory system's complexity and its implications in various physiological and pathological conditions, including mood regulation and neurological disorders. Understanding the structure and function of OR8K1 could provide insights into olfactory signal transduction mechanisms and their potential therapeutic targets. Recent studies have focused on expressing OR8K1 as a recombinant protein to facilitate the investigation of its biochemical properties, ligand-binding characteristics, and interaction with G-proteins. This approach enables researchers to dissect the receptor's signaling pathways and explore its role in the broader context of sensory biology. Additionally, recombinant OR8K1 could be useful in developing biosensors for detecting specific odorants, contributing to applications in fields such as food quality control and environmental monitoring. The expression and characterization of OR8K1 as a recombinant protein may also open avenues for the exploration of its evolutionary significance within the olfactory receptor gene family, enhancing our understanding of how olfactory systems have adapted across different species. Overall, the study of OR8K1 recombinant protein is poised to provide valuable insights into olfactory receptor biology, with potential advancements in biotechnology and therapeutic strategies related to sensory disorders.
