Analytical Data
-
Gene name
OR9A4
- Application
-
Alternative Names
OR9A4; Olfactory receptor 9A4; Olfactory receptor OR7-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGU2
-
Expression Region
1-314 aa
-
AA Sequence
MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYF FLGHLSALEILVTTIIVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAV DRYVAVCNPLRYNIIMNRHTCNFVVLVSWVFGFLFQIWPVYVMFQLTYCKSNVVNNFFCD RGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTILKIPSSSGRRKSFST CASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA LRDGVKRCCQLFRN
-
Molecular Weight
35.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR9A4 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of smell. It is localized in the nasal epithelium, where it participates in the detection of specific odorant molecules. Despite the importance of ORs in olfaction, the functional characterization of OR9A4 remains limited. Recent studies have shown that specific ORs can also influence neurobiological processes beyond olfaction, suggesting a broader role in the central nervous system. The expression of OR9A4 in various tissues raises questions about its potential functions outside the olfactory system. The recombinant protein of OR9A4 offers an innovative approach to study its structural and functional properties. By producing this protein in a laboratory setting, researchers can investigate the ligand-binding capabilities of OR9A4, elucidate its signaling pathways, and explore its interactions with other cellular components. Understanding the mechanisms governed by OR9A4 may contribute to a better grasp of olfactory signaling and its implications in neurobiology, potentially opening new avenues for therapeutic interventions in olfactory dysfunction and related disorders. Furthermore, given the challenges associated with studying GPCRs (G protein-coupled receptors) like OR9A4 in native environments, the availability of this recombinant protein is pivotal for advancing our knowledge and research in the field of sensory biology.
