Analytical Data
-
Gene name
OR8H2
- Application
-
Alternative Names
OR8H2; Olfactory receptor 8H2; Olfactory receptor OR11-171
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N162
-
Expression Region
1-312 aa
-
AA Sequence
MMGRRNNTNVADFILMGLTLSEEIQMALFMLFLLIYLITMLGNVGMILIIRLDLQLHTPM YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFFFAFLGTAECYLLSSMAH DRYAAICSPLHYTVIMSKRLCLALITGPYVIGFIDSFVNVVSMSRLHFYDSNVIHHFFCD TSPILALSCTDTYNTEILIFIIVGSTLMVSLFTISASYVFILFTILKINSTSGKQKAFST CVSHLLGVTIFYSTLIFTYLKPRKSYSLGRDQVASVFYTIVIPVLNPLIYSLRNKEVKNA VIRVMQRRQDSR
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR8H2 protein, a member of the olfactory receptor family, has garnered significant attention in recent years due to its role in mediating olfactory perception. These receptors are G protein-coupled receptors (GPCRs) responsible for detecting volatile odor molecules and are crucial for the sense of smell. While approximately 400 functional olfactory receptor genes exist in the human genome, the specific functions and mechanisms of many remain poorly understood. The study of OR8H2, in particular, is important as it has been linked to the perception of certain odorants, which may have implications for taste and flavor identification. Research has shown that variations in olfactory receptor genes can influence individual differences in olfactory sensitivity and preferences. Additionally, decoding the signaling pathways and ligand interactions of OR8H2 could provide insights into broader physiological processes and potential therapeutic targets for disorders related to olfactory dysfunction. Recent advances in recombinant protein expression techniques facilitate the production of large quantities of OR8H2, paving the way for detailed structural and functional studies. Understanding the characteristics of OR8H2 in various contexts, including its interaction with odorants and involvement in the neural pathways of olfaction, will contribute to a clearer picture of olfactory receptor functionality and their impact on human behavior and health. Overall, research on OR8H2 serves as a crucial stepping stone toward unraveling the complex mechanisms of olfactory perception and could lead to innovative applications in fragrance and flavor industries, as well as in developing olfactory-based therapies.
