Analytical Data
-
Gene name
THOC7
- Application
-
Alternative Names
THOC7；NIF3L1BP1；THO complex subunit 7 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6I9Y2
-
Expression Region
1-204aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGAVTDDEVIRKRLLIDGDGAGDDRRI NLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLRE MENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQ HHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHEL QQTLENDEKLSEVEEAQEASMETDPKP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
THOC7, or the THO complex subunit 7, is a protein that has garnered significant attention in the fields of molecular biology and genetics due to its critical role in mRNA export and gene expression regulation. Research into THOC7 has emerged from the need to understand the intricate mechanisms of RNA processing and transport within eukaryotic cells. This protein is a part of the THO complex, which is essential for the export of mRNA from the nucleus to the cytoplasm, playing a vital role in ensuring the integrity and functionality of the mRNA molecules. Dysregulation of THOC7 and its associated pathways has been implicated in various diseases, including cancer and neurological disorders, highlighting its potential as a therapeutic target. Additionally, studies have shown that THOC7 may interact with other proteins involved in splicing and transcription, further emphasizing its importance in cellular function. The investigation of THOC7 and its functions not only enhances our understanding of RNA biology but also provides insights into the intricate relationships between gene expression and cellular health, making it a compelling subject of ongoing research in the broader context of cell biology and disease mechanisms.
