Cat: PA1000-3194

Recombinant Human THOC7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    THOC7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    THOC7;NIF3L1BP1;THO complex subunit 7 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6I9Y2

  • Expression Region

    1-204aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMGAVTDDEVIRKRLLIDGDGAGDDRRI NLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLRE MENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQ HHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHEL QQTLENDEKLSEVEEAQEASMETDPKP

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

THOC7, or the THO complex subunit 7, is a protein that has garnered significant attention in the fields of molecular biology and genetics due to its critical role in mRNA export and gene expression regulation. Research into THOC7 has emerged from the need to understand the intricate mechanisms of RNA processing and transport within eukaryotic cells. This protein is a part of the THO complex, which is essential for the export of mRNA from the nucleus to the cytoplasm, playing a vital role in ensuring the integrity and functionality of the mRNA molecules. Dysregulation of THOC7 and its associated pathways has been implicated in various diseases, including cancer and neurological disorders, highlighting its potential as a therapeutic target. Additionally, studies have shown that THOC7 may interact with other proteins involved in splicing and transcription, further emphasizing its importance in cellular function. The investigation of THOC7 and its functions not only enhances our understanding of RNA biology but also provides insights into the intricate relationships between gene expression and cellular health, making it a compelling subject of ongoing research in the broader context of cell biology and disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US