Analytical Data
-
Gene name
CD1c
- Application
-
Alternative Names
CD1c；T-cell surface glycoProtein CD1c
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29017
-
Expression Region
18-302aa
-
AA Sequence
NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD1c is a member of the CD1 family of glycoproteins, which play a crucial role in the immune system by presenting lipid antigens to T cells. Research into CD1c and its recombinant protein form has gained significant attention due to its potential implications in understanding immune responses, particularly against lipid-based antigens associated with various diseases, including infections and cancer. CD1c is expressed on antigen-presenting cells, and its ability to present a broad range of lipid antigens makes it a unique target for vaccine development and immunotherapy. Moreover, studying CD1c using recombinant protein technology allows researchers to elucidate its structure-function relationships, enhancing our comprehension of how lipid antigens are recognized and processed. This research can unveil new therapeutic opportunities for boosting immune responses against pathogens or tumors. Understanding CD1c’s role in the immune system may also contribute to advancements in the treatment of autoimmune diseases and allergies, where lipid antigens might play a significant part. The ongoing exploration and characterization of CD1c recombinant protein are thus pivotal in the broader context of immunology and therapeutic development.
